अंग्रेज़ी किताबें जो «PHAGOCYTOTIC» से संबंधित हैं
निम्नलिखित ग्रंथसूची चयनों में
phagocytotic का उपयोग पता करें।
phagocytotic aसे संबंधित किताबें और अंग्रेज़ी साहित्य में उसके उपयोग का संदर्भ प्रदान करने वाले उनके संक्षिप्त सार।.
1
Rice is Life Scientific Perspectives for the 21st Century
VNPHDHQNLKIIWKAIPVNKPGRYDDFFLSSTQAQQ
VNPHDHQNLKMIWLAIPVNKPGRYDDFFLSSTQAQQ 4.0 Phagocytotic index
123 BC Fig. 2. Development of rice to stimulate human phagocytotic activity. (A)
Substitution of amino acids of ...
2
METHODS IN CELL BIOLOGY,VOLUME 28: DICTYOSTELIUM DISCOIDEUM: ...
Isolation of mutants with altered phagocytotic properties can help to dissect the
complex process of phagocytosis into individual steps. Mutants of D. discoideum
selected for changes in motility which are consequently impaired in phagocytosis
...
The cells that are included in the mononudear phagocytotic system (MPS) are
derived from monocytes and denote a population of antigen-presenting cells
involved in the processing of foreign substances. These cells are able to
phagocytose ...
Michael H. Ross, Wojciech Pawlina, 2006
4
Congenital, Hereditary, and Neonatal Diseases and ...
phagocytotic. dysfunction,. by. activating. BK. channels. “Unoprostone isopropyl (
unoprostone) is a docosanoid currently used as an antiglaucoma agent.
Unoprostone is known to have neuroprotective effects and to activate large
conductance ...
5
Receptor Protein-Tyrosine Kinases—Advances in Research and ...
For additional information, contact M.S. Devi, University of Kerala, Dept. of
Biochemistry, Kariavattom, Thiruvananthapuram, Kerala 695 581, India. (2011
FEB 22) University of Kiel: Nicotine reduces VEGF-secretion and phagocytotic
activity in ...
6
Phagocytosis: New Insights for the Healthcare Professional: ...
(2010 APR 19) University of Kiel: Intracellular bevacizumab reduces phagocytotic
uptake in RPE cells A report, 'Intracellular bevacizumab reduces phagocytotic
uptake in RPE cells,' is newly published data in Graefe's Archive for Clinical and
...
7
Environmental monitoring and assessment program: ecological ...
G.2.8 INDICATOR: Macrophage Phagocytotic Activity CATEGORY: Exposure and
Habitat/ Biomarkers STATUS: Research APPLICATION: The immune system, in
its capacity to destroy foreign material and protect the host against disease, can ...
Carolyn Thomas Hunsaker, Dean Earl Carpenter, Atmospheric Research and Exposure Assessment Laboratory (U.S.), 1990
8
Biomimetic Materials And Design: Biointerfacial Strategies, ...
While Schwann cells and olfactory ensheathing cells are attractive components
of biomimetic devices due to their roles in myelination and axon guidance,
macrophages and other phagocytotic cells perform the critical function of debris ...
Angela Dillow, Anthony Lowman, 2002
9
Eicosanoids in Invertebrate Signal Transduction Systems
Phagocytosis assays conducted in the presence of indomethacin, es- culetin, and
dexamethasone yielded sharply different indices. These experiments were
designed to consider the relationship between drug dosage and phagocytotic
index.
David Warren Stanley, 2000
10
Myotatic, Kinesthetic and Vestibular Mechanisms
The “dark” cells, on the other hand, were found to produce pseudopodia
embracing injected material or cellular debris and forming membrane-bounded
vacuoles around these elements, thus demonstrating a phagocytotic activity by
which ...
CIBA Foundation Symposium, 2009
«PHAGOCYTOTIC» पद को शामिल करने वाली समाचार सामग्रियां
इसका पता लगाएं कि राष्ट्रीय और अंतर्राष्ट्रीय प्रेस ने निम्नलिखित समाचार सामग्रियों के बारे में क्या चर्चा की है और इस संदर्भ में
phagocytotic पद का कैसे उपयोग किया है।
Discarded neutrophils release stem cells from bone marrow into …
... migrate to the bone marrow to be eliminated by specialized phagocytotic cells called macrophages. The act of phagocytosing the neutrophils ... «News-Medical.net, मई 13»
Scientists unravel the cause of rare genetic disease: Goldman-Favre …
... cell culture techniques, scientists demonstrated that the phagocytotic defect was due to the ESCS photoreceptors themselves, rather than the ... «EurekAlert, अगस्त 11»
Smoking increases risk of developing active TB
... on the tracheobronchial mucosal surface, reduced phagocytotic function of pulmonary alveolar macrophages, decreased production of tumor ... «EurekAlert, अगस्त 09»
For nanotechnology researchers size matters - but shape is crucial, too
Current scientific thought is that the upper limit of the size of any nanoparticle internalized into non-phagocytotic cells by means of non-specific ... «Nanowerk LLC, सितंबर 08»