«ALDOLASE» 관련 영어 책
다음 도서 목록 항목에서
aldolase 의 용법을 확인하세요.
aldolase 에 관련된 책과 해당 책의 짧은 발췌문을 통해 영어 서적에서 단어가 사용되는 맥락을 제공합니다.
1
Expanding the Synthetic Utility of KDPG
Aldolase
This dissertation describes efforts to understand the relationship between the primary amino acid sequence of an enzyme and the activity of the fully folded protein.
Corey Patrick Causey, 2007
2
The Role of the
Aldolase: Microneme 2 Protein Interaction to ...
aldolase may be similar to the interaction between aldolase and F-actin and we
sought to elucidate the contribution of these acidic residues to the aldolase
interaction. The proximal acidic residues in the MIC2t were shown to be essential
for ...
The changes in aldolase isoenzymes induced by these carcinogens became
irreversible over a 10-month period. The evidence for an aldolase in hepatomas
having activity ratios and electrophoretic mobility similar to those of aldolase A
did ...
4
Determining the Specificity of Pepsin for Proteolytic Digestion
Aldolase 211-229 AAVYKALSDHHIYLEGTLL Aldolase 211-239
AAVYKALSDHHIYLEGTLLKPNMVTPGHA Aldolase 211-247
AAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKYSHE Aldolase 212-229
AVYKALSDHHIYLEGTLL Aldolase ...
Melissa H. Palashoff, 2008
5
Enzymes in Synthetic Organic Chemistry
1 OH A ^ FDP aldolase OP DHAP OH (PO = phosphate) D-Gly 3-P D-FDP Figure
1. Aldol addition reaction catalyzed in vivo by FDP aldolase. and II enzymes have
been isolated from a variety of eukaryotic and prokaryotic sources, which ...
Chi-Huey Wong, G. M. Whitesides, 1994
6
Springer Handbook of Enzymes: Synonym Index
aldoketomutase lactoylglutathione lyase ц*«-- Aldolase Fructose-bisphosphate
aldolase •Jt&kt. Wfrffki-. 4.1.2.30 4.1.2.34 4.1.2.20 Aldolase, 1 7a-
hydroxyprogesterone 17a-Hydroxyprogesterone aldolase Aldolase, 2'-
carboxybenzalpyruvate ...
Dietmar Schomburg, Ida Schomburg, 2001
7
Photosynthesis: Physiology and Metabolism
Fructose-1,6-bisphosphate aldolase (EC 4.12.1.13, aldolase) catalyzes the
reversible aldol condensation of dihydroxyacetone phosphate and either GA3P
or erythrose-4-phosphate to yield fructose-1,6bisphosphate or sedoheptulose-l ...
Richard C. Leegood, Thomas D. Sharkey, Susanne von Caemmerer, 2000
8
The Prokaryotes: Vol. 4: Bacteria: Firmicutes, Cyanobacteria
Class I Aldolase Aldolase is one of the key enzymes of the glycolytic pathway.
There are two forms of fructose-1,6-bisphosphate aldolase which can be
differentiated by their catalytic and structural properties. Class I aldolases
function via the ...
Martin Dworkin, Stanley Falkow, 2006
9
Clinical Chemistry: an overview ; [proceedings of the 13th ...
MOLECULAR BIOLOGY OF THE HUMAN ALDOLASE ISOENZYME GENE
FAMILY Francesco Salvatore, Paola Izzo, Paola Costanzo and Rita Santamaria
Istituto di Scienze Biochimiche, II Facoltà di Medicina, via S. Pansini, 5, I-80131
Naples ...
10
ADVANCES IN CANCER RESEARCH
The study of ontogenic evolution of the isoenzymic aldolase distribution is of
special interest for the modifications in cancerous tissues: Hers and Joassin (
1961) and Schapira et al. (1962) pointed out that the substrate specificity of
aldolase in ...
George Klein, Jesse P Greenstein, Sidney Weinhouse, 1974
«ALDOLASE» 단어를 포함하는 뉴스 기사
다음 뉴스 기사의 맥락에서 국내 및 국제 언론이 말하는 내용 및
aldolase 단어를 사용하는 방법을 알아보세요.
Ecophysiology of an uncultivated lineage of Aigarchaeota from an …
Gluconeogenesis is also possible and the key enzyme fructose 1,6-bisphosphate aldolase/phosphatase is present, which has the conserved ... «Nature.com, 7월 15»
Fermentation 2015: The ABE process
The next enzyme in the process, fructose-bisphosphate aldolase, cleaves fructose-1,6-diphosphate into two isomeric molecules, ... «Speciality Chemicals Magazine, 6월 15»
Share this article
Abbreviations: ACO - aconitase; ALDO - fructose-bisphosphate aldolase; CS - citrate synthase; ENO - enolase; FH - fumarase; GAPDH ... «BMC Blogs Network, 5월 15»
The maize cytochrome P450 CYP79A61 produces …
Application of a high-throughput HPLC-MS/MS assay to Arabidopsis mutant screening; evidence that threonine aldolase plays a role in seed ... «BMC Blogs Network, 5월 15»
Simple method for selective bioconjugation of native proteins
The authors tested their procedure with aldolase, a homotetramer with eight free cysteines per subunit. They were able to successfully modify ... «Phys.Org, 4월 15»
Comparative genome analysis of Pediococcus damnosus LMG …
Dihydroneopterin aldolase subsequently releases glycoaldehyde to produce 6-hydroxymethyl-7,8-dihydropterin, which is then ... «BMC Blogs Network, 4월 15»
Evaluation of Ebola Virus Inactivation Procedures for Plasmodium …
The T2 band of BinaxNOW RDT, which is specific to pan-Plasmodium aldolase, varied by the level of parasitemia, with the T2 band being absent in 9 of 16 ... «Journal of Clinical Microbiology, 3월 15»
Evaluating a Young Patient with Joint Pain and Stiffness
If CK is elevated I typically repeat it and order aldolase to confirm an inflammatory myopathy. Either or both ESR and CRP should be elevated ... «HCPLive, 3월 15»
DSM cuts out China's ATS-8 intermediate middlemen with enzyme …
... Innovation awards last week], uses our own enzyme DERA [deoxyribose phosphate aldolase] to efficiently manufacture our intermediate.”. «In-PharmaTechnologist.com, 10월 14»
Come sconfiggere malattie gravi? Un medico e una terapia da …
Mor F., Izak M., Cohen IR., Identification of aldolase as a target antigen in Alzheimer's disease, J. Immunol. 2005 Sep. 1, 175(5), 3439-45; 20. «Tigullio News, 12월 13»