«ARCHAEBACTERIUM» தொடர்புடைய ஆங்கிலம் புத்தகங்கள்
பின்வரும் புத்தக விவரத்தொகுப்புத் தேர்ந்தெடுப்பில்
archaebacterium இன் பயன்பாட்டைக் கண்டறியுங்கள்.
archaebacterium தொடர்பான புத்தகங்கள் மற்றும் ஆங்கிலம் இலக்கியத்தில் அதன் பயன்பாட்டுச் சூழலை வழங்குவதற்கு அதிலிருந்து பெறப்பட்ட சுருக்கமான சாரங்களைத் தொடர்புபடுத்துகின்றன.
1
Colloquium on Variation and Evolution in Plants and ...
(3)] led Gupta (10) to conclude “all eukaryotic cells, including amitochondriate
and aplastidic cells received major genetic contributions to the nuclear genome
from both an archaebacterium (very probably of the eocyte, i.e., thermoacidophil
...
Francisco Jos_ Ayala, Walter M. Fitch, Michael I. Chegg, 2000
2
Autoimmune Liver Disease
... Worm
MIPVGAGEREGRVLTPLVQRLHSNLTHGIGRSGNLLEIQPKALGSSMLAC
Archaebacterium
MDTDKDPNWQIGEREARVYTKLQRDGVFDFCHGVGRSGNLIDPQPKAPGASVMYK
Man ITNSLVLDI ...
H.-P. Dienes, U. Leuschner, A.W. Lohse, 2005
3
Natural Terpenoids as Messengers: A Multidisciplinary Study ...
Another possibility is an early fusion between an archaebacterium and an
eubacterium, which means a primary endosymbiosis of the nucleus and a
secondary symbiosis in connection with the acquisition of the mitochondrion.
According to ...
Paul Harrewijn, A.M. van Oosten, P.G. Piron, 2001
4
The Nitrogenase in a Methanogenic
Archaebacterium and Its ...
Diazotrophic growth was stimulated by Molybdenum and inhibited by tungsten, suggesting that the nitrogenase is a molybdoenzyme. We have purified the nitrogenase 30-40-fold, and have found that it is a two-component enzyme, as in eubacteria.
Stephan H. Zinder, NEW YORK STATE COLL OF AGRICULTURE AND LIFE SCIENCES ITHACA DEPT OF MICROBIO LOGY., 1990
5
The Prokaryotes: Vol. 3: Archaea. Bacteria: Firmicutes, ...
1987b. The plasma membrane ATPase of the thermoacidophilic
archaebacterium Sulfolobus acidocaldarius. Purification and immunological
relationships to F[1]-ATPases. Eur. J. Biochem. 167:211-219. Liibben, M., and G.
Schafer. 1989.
Martin Dworkin, Stanley Falkow, 2006
function of the DNA dependent RNA polymerase of the archaebacterium
Thermaplasma acidophilum. Zentralbl. Bakteriol., Mikrobiol. Hyg., Abt. I, C 1, 12—
25. Thomm, M. (1983). Aufbau, Eigenschaften und immunologische
Verwandtschaft der ...
... (1988) Comparative evaluation of gene expression in archaebacteria. Eur. J.
Biochem. 173:473- 482. 21) Itoh, T. (1988) Complete nucleotide sequence of the
ribosomal 'A' protein operon from the archaebacterium, Halobacterium halobium.
8
Electrogenic Reactions in Photosynthetic Reactions Centres ...
Chinchaladze, D.Z., Prangishvili, D.A., Kachabava, L.A. and Zaalishvili, M.M. (
1984) DNA-dependent DNA polymerase of the thermoacido- philic
archaebacterium Thermoplasma acidophitum, Bulletein Acad. Set. Georg. SSR,
113. 161-164 ...
D. A. Prangishvili, G. D. Muskhelishvili, 1991
9
Polyextremophiles: Life Under Multiple Forms of Stress
Syst Appl Microbiol 4:79-87 Zillig W, Holz I, Janekovic D, Schaer W, Reiter WD (
1983b) The archaebacterium Thermococcus celer represents, a novel genus
within the thermophilic branch of the archaebacteria. Syst Appl Microbiol 4:88-94
...
Joseph Seckbach, Aharon Oren, Helga Stan-Lotter, 2013
10
Essential Readings in Evolutionary Biology
We reconstruct the fusion event that produced the nucleus. The Chimera:
Archaebacterium/Eubacterium Merger Study of conserved protein sequences [a
far larger data set than that used by Woese et al. (3)] led Gupta (10) to conclude “
all ...
Francisco J. Ayala, John C. Avise, 2014
«ARCHAEBACTERIUM» வார்த்தையைக் கொண்டுள்ள புதிய உருப்படிகள்
பின்வரும் செய்தி உருப்படிகளின் சூழலில்
archaebacterium என்ற வார்த்தையைப் பயன்படுத்துவது பற்றியும் எப்படிப் பயன்படுத்துவது என்பதைப் பற்றியும் தேசிய மற்றும் பன்னாட்டு அச்சகங்கள் என்ன பேசியிருக்கின்றன என்பதைக் கண்டறியுங்கள்.
Origin of the Eukaryotic cell: Part I - How to train your endosymbiont
... whose origins refute the now popular theory that eukaryotes originated by merging an archaebacterium with an alphaproteobacterium. «Phys.Org, டிசம்பர் 14»
Distantly Related Viruses Proliferate Similarly
A virus that infects the hot spring archaebacterium Sulfolobus solfataricus has been found to recruit the same set of host proteins that human ... «Scientist, ஜூன் 13»
How to Thrive in Battery Acid and Among Toxic Metals
... exist in hundreds of copies in its genome, all descending from a single gene the alga copied millions of years ago from an archaebacterium. «Space Daily, மார்ச் 13»
Optogenetics Pioneers Win Zülch
The single-cell freshwater alga Chlamydomonas reinhardtii and the salt lake archaebacterium Natronomonas pharaonis have light-sensing ... «Photonics.com, செப்டம்பர் 12»
In the ring: Researchers fighting bacterial infections zero in on …
The researchers performed their analysis and experiments on FtsZ from the archaebacterium Methanococcus jannaschii, which thrives in ... «Eureka! Science News, ஜூலை 10»
Neural 'traffic light' a 'go' for better brain research
In this week's paper, they demonstrate that another gene, NpHR, which is borrowed from a microbe called an archaebacterium, can make ... «Stanford Report, ஏப்ரல் 07»
Microbe Yields Glycobiology Reagent
... on these unusual microbes proved to be wise: Her lab recently isolated the first NDP-sugar-synthesizing enzymes from an archaebacterium. «Chemical & Engineering News, பிப்ரவரி 05»
The beak of the squid
... conducting x-ray crystallographic studies of an Argonaute protein (PfAgo) from the hyperthermophilic archaebacterium, Pyrococcus furiosus. «Innovations-Report, ஆகஸ்ட் 04»