WHAT DOES गददी MEAN IN HINDI?
Click to
see the original definition of «गददी» in the Hindi dictionary.
Click to
see the automatic translation of the definition in English.
Definition of गददी in the Hindi dictionary
Gaddi Noun Female 0 [Hint 0 Gadda's Female 0 and Alpa 0] 1. small Mattress 2. The clothes that stick on the back of the horse, camel etc. Or gene etc. 3. Businessman Place of seating As such, - Saraf's cows, Kalwar's cows, Mahant's casket U-Indra's Seeing me on my throne. Laxmansingh (Word 0). Yo0-Rajgadadi Gaddinishin Muha0-sit on the throne = (1) Throne 2. Being successor Sit-in Sitting with rest. 5. The disciples of a dynasty or the disciples of Acharya. For example, - (a) After four asses, there will be no one in this lineage. (B) This is ... the fourth gaddi of the master. Idiom-fencing = the continuation of ancestral or discipleship Happen . The sequence of successors 6. Soft cloth Put down 7. Hand or foot palm Muha0-matting = rub the horse with palm or nudge 8. Ceramic potskin Do printing work. गददी संज्ञा स्त्री० [हिं० गददा का स्त्री० और अल्पा०]
१. छोटा
गददा । २. वह कपडा़ जो घोडे़, ऊँट आदि की पीठ पर काठी
या जीन आदि रखने के लिये डाला जाता है । ३. व्यवसायी
आदि के बैठने का स्थान । जैसे,— सराफ की गददी, कलवार की गददी, महंत की गददी । उ०—इंद्र ने देवताओं के
देखते मुझे अपनी गददी पर बिठाया ।—लक्ष्मणसिंह
(शब्द०) ।
यौ०—राजगददी । गददीनशीन ।
मुहा०—गददी पर बैठना = (१) सिंहासनारूढ़ होना । २.
उत्तराधिकारी होना । गददी लगाकर बैठना = अधिकार जताते
हुए आराम के साथ बैठना ।
५. किसी राजवंश की पीढी़ या आचार्य की शिष्यपरंपरा ।
जैसे,—(क) चार गददी के बाद इस वंश में कोई न रहेगा ।
(ख) यह ... गुरु की चौथी गददी है ।
मुहा०—गददी चलाना = वंशपरंपरा या शिष्यपरंपरा का जारीं
होना । उत्तराधिकारियों का क्रम चलना ।
६. कपडे़ आदि की बनी हुई वह मुलायम तह जो किसी चीज के
नीचे रखी जाय । ७. हाथ या पैर की हथेली ।
मुहा०—गददी लगाना = घोडे़ को हथेली या कुहनी से मलना ।
८. एक प्रकार का मिट्टी का गोल बरतन जिसमें छीपी रंग रखकर
छपाई का काम करते हैं ।
Click to
see the original definition of «गददी» in the Hindi dictionary.
Click to
see the automatic translation of the definition in English.
10 HINDI BOOKS RELATING TO «गददी»
Discover the use of
गददी in the following bibliographical selection. Books relating to
गददी and brief extracts from same to provide context of its use in Hindi literature.
1
Kaccha kī Brajabhāshā pāṭhaśālā evaṃ usase sambaddha ...
महारावयो प्रागमलेरजी के देहान्त के बाद उनके पूई प्रसिद्ध ३तयोर पाटनी स्वर गोय गादी का आए | गोय महाराव बहुत कम समय गददी पर के बलिका उनका शासन काल जाटेजा का में कोतिमोन होता ...
Nirmalā Ena Āsanāṇī, 1996
2
Vakataka-Gupta Yug Laghbhag 200-550 E Tak Bhartiya Jan Ka ...
उसके उत्तराधिकारी होर्युजा३य ने केवल सात वर्ष ( 303 ई० से 310 ई० ) शासन किया : पूरब की ओर उसके किसी अभियान का उल्लेख नहीं मिलता 1 उसके बाद जापुर द्वितीय जब 31 0 ई० में गददी पर आया तो ...
R. C. Majumdar, 'a. S. Altekar, 2002
3
Bharat Ke Gaon: - Page 55
सबसे पाले तो गइले चम्बा रियासत का वासी है, जिसका राजा गददी नहीं है । यह गो-ग-द राजा तहसीलदार नियुक्त करता था, सामान्य पज्ञासनिय क्रियाकलापों बहे नियन्दित करता था, अत पाले ...
Mysore Narasimhachar Srinivas, 2000
4
Ḍuggara kā loka sāhitya - Page 157
एव' रीछ की एक गददी से मित्रता हो जाना, रीछ द्वारा गदहे को उसकी कन्या के विवाह में सहायता करना, मती द्वारा विवाहोत्सव में रीछ को भी आमंत्रित करना, भोजन परोसते समय रीछ का ...
5
Venomous Reptiles and Their Toxins: Evolution, ... - Page 270
YPDSPGTTTSS- PCYTLDH-GDDI -MLIKLNASVTYNEHIAPMALPDHAVPLGTECDIIGWGETELIVDTASDVPL 6. PDSPGTTNSS-CPSFTLDS-GDDI-------------MLIGLNASVTYNEHIAPMALPDHAAPLGTECNIIGWGETELIVGSPSEVPL 7.
6
New Horizons in Nitrogen Fixation: Proceedings of the 9th ... - Page 12
8. SECP..4... GDDI [27i c. 6...sosLGHH [91] nLvićyR [166] oil. 5...GPy . . GDDI [28] £:##! NVVNCAR [164] NGH. . 4. . GPY . . 8. - RGCAF [25] HGPLGCAYD [70 P.. 8..TTCP.. 4 RGCAY [25] HGPVGCTYD [70] P.. 8...QTCP. . 4. . GDDI [28] .
Rafael Palacios, Jaime Mora, William E. Newton, 2013
7
Modern Methods for Theoretical Physical Chemistry of ... - Page 30
Although up to now the primary target of GDDI is the FMO method, other usages have been reported (numeric gradients in [43]) and more can be conceived. The scheme of GDDI is shown in Fig. 1.10(a). Nodes need not be of the same type, ...
Evgeni Starikov, James P. Lewis, Shigenori Tanaka, 2011
8
The Fragment Molecular Orbital Method: Practical ... - Page 27
2.5 PRACTICAL ASPECTS OF PERFORMING FMO CALCULATIONS IN GAMESS 2.5.1 Parallelization FMO in GAMESS is parallelized with the two-level hierarchical method, generalized distributed data interface (GDDI).77 The underlying ...
Dmitri Fedorov, Kazuo Kitaura, 2009
9
Crises, Conflict and Disability: Ensuring Equality - Page 52
A critical component of each WILD programme is the four-day Gender, Disability, and Development Institute (GDDI) in which representatives of international development and humanitarian agencies meet with WILD delegates to focus on the ...
David Mitchell, Valerie Karr, 2014
10
Analog Signal Processing - Page 50
Voltages at the amplifier output can be obtained by first calculating its input voltages, ^iD = GDDi^d + GDCiKc (2.l5a) ^c = GCDl^ + GcaKc (2.l5b) By substituting into (2.4a) and (2.4b), V0D = GDD(GDDl Vd + GDC Kc) + G^GCK Vd + GCG Ke) ...
Ramón Pallás-Areny, John G. Webster, 1999
4 NEWS ITEMS WHICH INCLUDE THE TERM «गददी»
Find out what the national and international press are talking about and how the term
गददी is used in the context of the following news items.
शबद कीर्तन कर मनाया गुरु गद्दी दिवस
एनबीटी, लखनऊ : नाका हिंडोला गुरुद्वारे में शुक्रवार को गुरु ग्रन्थ साहिब जी का गुरु गददी दिवस मनाया गया। कार्यक्रम की शुरुआत सुबह 5 बजे सुखमणि साहिब के पाठ के विशेष दीवान के साथ हुई। यूथ खालसा असोसिएशन की ओर से गुरु सिंह सभा में ... «नवभारत टाइम्स, Nov 15»
थाली से दाल गायब, केंद्र कह रही बंदरगाह पर आ गयी …
उन्होंने आरोप लगाया कि आज महंगाई चरम पर पहुंच गयी है और दिल्ली की गददी मिलते ही प्रधानमंत्री नरेन्द्र मोदी चादर ओढ़कर सो रहे हैं। आज महाराष्ट्र में भाजपा की सरकार है वहां बिहारियों को अपमानित किया जा रहा है। जो बिहारी मराठी नहीं ... «दैनिक जागरण, Oct 15»
गुदरिया बाबा की रामलीला से हुआ विश्व में …
सभी भाषाओं के साथ ही हर तरह से वह पूर्ण ज्ञानी थे, गहदे का सिर लगाना ब्राहमण का अपमान होगा, इसलिए गहदे का सिर दोबारा नही लगाया गया। गूदर अखाड़े की संत परंपरा की 14 वीं गददी के संत राघवदास कहते हैं कि लगभग सौ साल पहले सिद्व हरिदास महराज के ... «दैनिक जागरण, Oct 15»
बहनों ने भाई की कलाई पर प्यार बांधा
धनिकलाल यादव के नेतृत्व में एसएसबी बटालियन मुख्यालय एवं कमला बीओपी के जवानों के कलाईयों पर राखी बाधी। वहीं सरस्वती शिशु मंदिर पटना गददी चौक जयनगर के छात्र छात्राओं एवं शिक्षकगण प्रधानाचार्य कृष्ण कुमार झा के नेतृत्व में विद्या ... «दैनिक जागरण, Aug 14»