Educalingo cookies are used to personalize ads and get web traffic statistics. We also share information about the use of the site with our social media, advertising and analytics partners.
Got it
Search

Meaning of "archaebacterium" in the English dictionary

Dictionary
DICTIONARY
section

PRONUNCIATION OF ARCHAEBACTERIUM

archaebacterium  [ˌɑːkɪbækˈtɪərɪəm] play
facebooktwitterpinterestwhatsapp

GRAMMATICAL CATEGORY OF ARCHAEBACTERIUM

noun
adjective
verb
adverb
pronoun
preposition
conjunction
determiner
exclamation
Archaebacterium is a noun.
A noun is a type of word the meaning of which determines reality. Nouns provide the names for all things: people, objects, sensations, feelings, etc.

WHAT DOES ARCHAEBACTERIUM MEAN IN ENGLISH?

Archaea

The Archaea are a domain or kingdom of single-celled microorganisms. These microbes are prokaryotes, meaning they have no cell nucleus or any other membrane-bound organelles in their cells. Archaea were initially classified as bacteria, receiving the name archaebacteria, but this classification is outdated. Archaeal cells have unique properties separating them from the other two domains of life: Bacteria and Eukaryota. The Archaea are further divided into four recognized phyla. Classification is difficult because the majority have not been studied in the laboratory and have only been detected by analysis of their nucleic acids in samples from their environment. Archaea and bacteria are similar in size and shape, although a few archaea have very strange shapes, such as the flat and square-shaped cells of Haloquadratum walsbyi. Despite this visual similarity to bacteria, archaea possess genes and several metabolic pathways that are more closely related to those of eukaryotes, notably the enzymes involved in transcription and translation. Other aspects of archaeal biochemistry are unique, such as their reliance on ether lipids in their cell membranes.

WORDS THAT RHYME WITH ARCHAEBACTERIUM


acroterium
ˌækrəʊˈtɪərɪəm
apodyterium
ˌæpəʊdɪˈtɪərɪəm
apterium
æpˈtɪərɪəm
bacterium
bækˈtɪərɪəm
corynebacterium
ˌkɒrənɪbækˈtɪərɪəm
criterium
kraɪˈtɪərɪəm
cyanobacterium
ˌsaɪənəʊbækˈtɪərɪəm
deuterium
djuːˈtɪərɪəm
elaterium
ˌɛləˈtɪərɪəm
enterobacterium
ˌɛntərəʊbækˈtɪərɪəm
eubacterium
ˌju:bækˈtɪərɪəm
imperium
ɪmˈpɪərɪəm
magisterium
ˌmædʒɪˈstɪərɪəm
ministerium
ˌmɪnɪˈstɪərɪəm
mycobacterium
ˌmaɪkəʊbækˈtɪərɪəm
nitrobacterium
ˌnaɪtrəʊbækˈtɪərɪəm
osmeterium
ˌɒzmɪˈtɪərɪəm
psalterium
sɔːlˈtɪərɪəm
puerperium
pjʊəˈpɪərɪəm
sericterium
ˌsɛrɪkˈtɪərɪəm

WORDS THAT BEGIN LIKE ARCHAEBACTERIUM

archaea
archaeal
archaean
archaebacteria
archaeoastronomer
archaeoastronomy
archaeobotanist
archaeobotany
archaeol.
archaeological
archaeologically
archaeologist
archaeology
archaeomagnetism
archaeometric
archaeometrist
archaeometry
archaeopteryx
archaeornis

WORDS THAT END LIKE ARCHAEBACTERIUM

aquarium
atrium
auditorium
barium
clavicytherium
crematorium
deinotherium
delirium
desiderium
dinotherium
emporium
equilibrium
meitnerium
nototherium
planetarium
pomoerium
sanatorium
solarium
terrarium
yttrium

Synonyms and antonyms of archaebacterium in the English dictionary of synonyms

SYNONYMS

Translation of «archaebacterium» into 25 languages

TRANSLATOR
online translator

TRANSLATION OF ARCHAEBACTERIUM

Find out the translation of archaebacterium to 25 languages with our English multilingual translator.
The translations of archaebacterium from English to other languages presented in this section have been obtained through automatic statistical translation; where the essential translation unit is the word «archaebacterium» in English.

Translator English - Chinese

古细菌
1,325 millions of speakers

Translator English - Spanish

arqueobacteria
570 millions of speakers

English

archaebacterium
510 millions of speakers

Translator English - Hindi

archaebacterium
380 millions of speakers
ar

Translator English - Arabic

archaebacterium
280 millions of speakers

Translator English - Russian

archaebacterium
278 millions of speakers

Translator English - Portuguese

archaebacterium
270 millions of speakers

Translator English - Bengali

archaebacterium
260 millions of speakers

Translator English - French

archéobactérie
220 millions of speakers

Translator English - Malay

Archaebacterium
190 millions of speakers

Translator English - German

Archaebakterium
180 millions of speakers

Translator English - Japanese

古細菌
130 millions of speakers

Translator English - Korean

archaebacterium
85 millions of speakers

Translator English - Javanese

Archaebacterium
85 millions of speakers
vi

Translator English - Vietnamese

archaebacterium
80 millions of speakers

Translator English - Tamil

archaebacterium
75 millions of speakers

Translator English - Marathi

आर्कबेबॅक्टीरियम
75 millions of speakers

Translator English - Turkish

archaebacterium
70 millions of speakers

Translator English - Italian

archebatterio
65 millions of speakers

Translator English - Polish

archaebacterium
50 millions of speakers

Translator English - Ukrainian

archaebacterium
40 millions of speakers

Translator English - Romanian

archaebacterium
30 millions of speakers
el

Translator English - Greek

αρχαιοβακτήριο
15 millions of speakers
af

Translator English - Afrikaans

archaebacterium
14 millions of speakers
sv

Translator English - Swedish

archaebacterium
10 millions of speakers
no

Translator English - Norwegian

archaebacterium
5 millions of speakers

Trends of use of archaebacterium

TRENDS

TENDENCIES OF USE OF THE TERM «ARCHAEBACTERIUM»

The term «archaebacterium» is used very little and occupies the 151.513 position in our list of most widely used terms in the English dictionary.
0
100%
FREQUENCY
Rarely used
29
/100
The map shown above gives the frequency of use of the term «archaebacterium» in the different countries.
Principal search tendencies and common uses of archaebacterium
List of principal searches undertaken by users to access our English online dictionary and most widely used expressions with the word «archaebacterium».

FREQUENCY OF USE OF THE TERM «ARCHAEBACTERIUM» OVER TIME

The graph expresses the annual evolution of the frequency of use of the word «archaebacterium» during the past 500 years. Its implementation is based on analysing how often the term «archaebacterium» appears in digitalised printed sources in English between the year 1500 and the present day.

Examples of use in the English literature, quotes and news about archaebacterium

EXAMPLES

10 ENGLISH BOOKS RELATING TO «ARCHAEBACTERIUM»

Discover the use of archaebacterium in the following bibliographical selection. Books relating to archaebacterium and brief extracts from same to provide context of its use in English literature.
1
Colloquium on Variation and Evolution in Plants and ...
(3)] led Gupta (10) to conclude “all eukaryotic cells, including amitochondriate and aplastidic cells received major genetic contributions to the nuclear genome from both an archaebacterium (very probably of the eocyte, i.e., thermoacidophil  ...
Francisco Jos_ Ayala, Walter M. Fitch, Michael I. Chegg, 2000
2
Autoimmune Liver Disease
... Worm MIPVGAGEREGRVLTPLVQRLHSNLTHGIGRSGNLLEIQPKALGSSMLAC Archaebacterium MDTDKDPNWQIGEREARVYTKLQRDGVFDFCHGVGRSGNLIDPQPKAPGASVMYK Man ITNSLVLDI ...
H.-P. Dienes, U. Leuschner, A.W. Lohse, 2005
3
Natural Terpenoids as Messengers: A Multidisciplinary Study ...
Another possibility is an early fusion between an archaebacterium and an eubacterium, which means a primary endosymbiosis of the nucleus and a secondary symbiosis in connection with the acquisition of the mitochondrion. According to ...
Paul Harrewijn, A.M. van Oosten, P.G. Piron, 2001
4
The Nitrogenase in a Methanogenic Archaebacterium and Its ...
Diazotrophic growth was stimulated by Molybdenum and inhibited by tungsten, suggesting that the nitrogenase is a molybdoenzyme. We have purified the nitrogenase 30-40-fold, and have found that it is a two-component enzyme, as in eubacteria.
Stephan H. Zinder, NEW YORK STATE COLL OF AGRICULTURE AND LIFE SCIENCES ITHACA DEPT OF MICROBIO LOGY., 1990
5
The Prokaryotes: Vol. 3: Archaea. Bacteria: Firmicutes, ...
1987b. The plasma membrane ATPase of the thermoacidophilic archaebacterium Sulfolobus acidocaldarius. Purification and immunological relationships to F[1]-ATPases. Eur. J. Biochem. 167:211-219. Liibben, M., and G. Schafer. 1989.
Martin Dworkin, Stanley Falkow, 2006
6
Archabacteria
function of the DNA dependent RNA polymerase of the archaebacterium Thermaplasma acidophilum. Zentralbl. Bakteriol., Mikrobiol. Hyg., Abt. I, C 1, 12— 25. Thomm, M. (1983). Aufbau, Eigenschaften und immunologische Verwandtschaft der ...
Carl R. Woese, 1985
7
Frontiers of Life:
... (1988) Comparative evaluation of gene expression in archaebacteria. Eur. J. Biochem. 173:473- 482. 21) Itoh, T. (1988) Complete nucleotide sequence of the ribosomal 'A' protein operon from the archaebacterium, Halobacterium halobium.
J. Thanh Van Tran, 1992
8
Electrogenic Reactions in Photosynthetic Reactions Centres ...
Chinchaladze, D.Z., Prangishvili, D.A., Kachabava, L.A. and Zaalishvili, M.M. ( 1984) DNA-dependent DNA polymerase of the thermoacido- philic archaebacterium Thermoplasma acidophitum, Bulletein Acad. Set. Georg. SSR, 113. 161-164 ...
D. A. Prangishvili, G. D. Muskhelishvili, 1991
9
Polyextremophiles: Life Under Multiple Forms of Stress
Syst Appl Microbiol 4:79-87 Zillig W, Holz I, Janekovic D, Schaer W, Reiter WD ( 1983b) The archaebacterium Thermococcus celer represents, a novel genus within the thermophilic branch of the archaebacteria. Syst Appl Microbiol 4:88-94  ...
Joseph Seckbach, Aharon Oren, Helga Stan-Lotter, 2013
10
Essential Readings in Evolutionary Biology
We reconstruct the fusion event that produced the nucleus. The Chimera: Archaebacterium/Eubacterium Merger Study of conserved protein sequences [a far larger data set than that used by Woese et al. (3)] led Gupta (10) to conclude “ all ...
Francisco J. Ayala, John C. Avise, 2014

8 NEWS ITEMS WHICH INCLUDE THE TERM «ARCHAEBACTERIUM»

Find out what the national and international press are talking about and how the term archaebacterium is used in the context of the following news items.
1
Origin of the Eukaryotic cell: Part I - How to train your endosymbiont
... whose origins refute the now popular theory that eukaryotes originated by merging an archaebacterium with an alphaproteobacterium. «Phys.Org, Dec 14»
2
Distantly Related Viruses Proliferate Similarly
A virus that infects the hot spring archaebacterium Sulfolobus solfataricus has been found to recruit the same set of host proteins that human ... «Scientist, Jun 13»
3
How to Thrive in Battery Acid and Among Toxic Metals
... exist in hundreds of copies in its genome, all descending from a single gene the alga copied millions of years ago from an archaebacterium. «Space Daily, Mar 13»
4
Optogenetics Pioneers Win Zülch
The single-cell freshwater alga Chlamydomonas reinhardtii and the salt lake archaebacterium Natronomonas pharaonis have light-sensing ... «Photonics.com, Sep 12»
5
In the ring: Researchers fighting bacterial infections zero in on …
The researchers performed their analysis and experiments on FtsZ from the archaebacterium Methanococcus jannaschii, which thrives in ... «Eureka! Science News, Jul 10»
6
Neural 'traffic light' a 'go' for better brain research
In this week's paper, they demonstrate that another gene, NpHR, which is borrowed from a microbe called an archaebacterium, can make ... «Stanford Report, Apr 07»
7
Microbe Yields Glycobiology Reagent
... on these unusual microbes proved to be wise: Her lab recently isolated the first NDP-sugar-synthesizing enzymes from an archaebacterium. «Chemical & Engineering News, Feb 05»
8
The beak of the squid
... conducting x-ray crystallographic studies of an Argonaute protein (PfAgo) from the hyperthermophilic archaebacterium, Pyrococcus furiosus. «Innovations-Report, Aug 04»

REFERENCE
« EDUCALINGO. Archaebacterium [online]. Available <https://educalingo.com/en/dic-en/archaebacterium>. Nov 2019 ».
en
English dictionary
Discover all that is hidden in the words on
index
a b c d e f g h i j k l m n o p q r s t u v w x y z